PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA07G0073600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 329aa    MW: 36501.6 Da    PI: 10.2127
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA07G0073600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.4e-1794140148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  ORGLA07G0073600.1  94 KGGWTREEDEVLRQMVRHHGDRKWAEIAKSLP-GRIGKQCRERWTNHL 140
                        688*****************************.************996 PP

2Myb_DNA-binding53.84.4e-17146189146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +g WT+eEd + ++a++ +G++ W++Iar ++ gR+++ +k+rw++
  ORGLA07G0073600.1 146 KGIWTEEEDRKVIRAHQTYGNR-WSAIARSLP-GRSENTVKNRWNT 189
                        678*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.58189144IPR017930Myb domain
SuperFamilySSF466892.57E-3091187IPR009057Homeodomain-like
SMARTSM007172.8E-1693142IPR001005SANT/Myb domain
PfamPF002499.8E-1694140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2596145IPR009057Homeodomain-like
CDDcd001671.65E-1597140No hitNo description
SMARTSM007171.1E-15145193IPR001005SANT/Myb domain
PROSITE profilePS5129417.355145195IPR017930Myb domain
PfamPF002491.1E-15146189IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-23146190IPR009057Homeodomain-like
CDDcd001671.54E-13149189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
WQPTGCRIVT LWASSNGGAC YQNTHGTPIT MGVPNLGCLV ASIGIAPSSS LMPERGLATA  60
NYNLVANFPE DAAVVPQQQQ LQAASSNSNS GLIKGGWTRE EDEVLRQMVR HHGDRKWAEI  120
AKSLPGRIGK QCRERWTNHL HPDIKKGIWT EEEDRKVIRA HQTYGNRWSA IARSLPGRSE  180
NTVKNRWNTT SEAXTQSADX GRKTVSKQCQ GSLPSSKSTS VAASTHCPMR RHHLHHSISV  240
GTAPVGRSVQ VQPHPQCMRW VDPLHWGWXC SLTYLTRLHR THHSQTXTCX TXHRWCHIST  300
LVDTAYSSMR GATVVWPAAG ATPRDQRPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-385819025154MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-385819025154MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645922.11e-121PREDICTED: transcriptional activator Myb-like
TrEMBLI1Q9E40.0I1Q9E4_ORYGL; Uncharacterized protein
STRINGORGLA07G0073600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.14e-41myb domain protein 118